PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK16488.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 85aa    MW: 10193 Da    PI: 11.4578
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK16488.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-17347147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg  T+ E+ +++++++++G++ W+tIar ++ gRt++++k++w+++
        PK16488.1  3 RGQITPHEESIILELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 47
                     7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.073152IPR017930Myb domain
SuperFamilySSF466891.09E-13253IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-20251IPR009057Homeodomain-like
SMARTSM007171.4E-14250IPR001005SANT/Myb domain
PfamPF002491.1E-14347IPR001005SANT/Myb domain
CDDcd001671.30E-9748No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
XKRGQITPHE ESIILELHAR WGNRWSTIAR SLPGRTDNEI KNYWRTHFKK KQAKVTSDAS  60
EKAKARLLKR QQFHQQQLHQ QQQQX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095222.12e-40Myb-related protein 305
SwissprotQ4JL761e-25MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLA0A0K0VKC62e-40A0A0K0VKC6_MORAL; Transcription factor GAMYB-like protein
TrEMBLW9R8W62e-40W9R8W6_9R
STRINGAT4G13480.11e-36(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-37myb domain protein 79